Lineage for d3kdod2 (3kdo D:136-444)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1824891Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 1825200Family c.1.14.0: automated matches [227297] (1 protein)
    not a true family
  6. 1825201Protein automated matches [227123] (6 species)
    not a true protein
  7. 1825234Species Thermococcus kodakaraensis [TaxId:69014] [226770] (2 PDB entries)
  8. 1825248Domain d3kdod2: 3kdo D:136-444 [212330]
    Other proteins in same PDB: d3kdoa1, d3kdob1, d3kdoc1, d3kdod1, d3kdoe1, d3kdof1, d3kdog1, d3kdoh1, d3kdoi1, d3kdoj1
    automated match to d1bxna1
    complexed with cap, mg; mutant

Details for d3kdod2

PDB Entry: 3kdo (more details), 2.36 Å

PDB Description: crystal structure of type iii rubisco sp6 mutant complexed with 2-cabp
PDB Compounds: (D:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3kdod2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kdod2 c.1.14.0 (D:136-444) automated matches {Thermococcus kodakaraensis [TaxId: 69014]}
fdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkddenlt
spwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkhamvd
vvitgwgalryirdlaadyglaihghramhaaftrnpyhgismfvlaklyrligidqlhv
gtagagklegerditlgfvdllreshykpdendvfhleqkfysikaafptssgglhpgni
qpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelaral
ekwghvtpv

SCOPe Domain Coordinates for d3kdod2:

Click to download the PDB-style file with coordinates for d3kdod2.
(The format of our PDB-style files is described here.)

Timeline for d3kdod2: