Lineage for d1ahwe2 (1ahw E:118-214)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8771Species Fab 5G9 (mouse), kappa L chain [49056] (2 PDB entries)
  8. 8777Domain d1ahwe2: 1ahw E:118-214 [21233]
    Other proteins in same PDB: d1ahwa1, d1ahwb1, d1ahwc1, d1ahwc2, d1ahwd1, d1ahwe1, d1ahwf1, d1ahwf2

Details for d1ahwe2

PDB Entry: 1ahw (more details), 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahwe2 b.1.1.2 (E:118-214) Immunoglobulin (constant domains of L and H chains) {Fab 5G9 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkki

SCOP Domain Coordinates for d1ahwe2:

Click to download the PDB-style file with coordinates for d1ahwe2.
(The format of our PDB-style files is described here.)

Timeline for d1ahwe2: