SCOP 1.55: Domain d1ahwe2: 1ahw E:118-214

Lineage for d1ahwe2 (1ahw E:118-214)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab 5G9 (mouse), kappa L chain [49056] (2 PDB entries)

8. Domain d1ahwe2: 1ahw E:118-214 [21233]
   Other proteins in same PDB: d1ahwa1, d1ahwb1, d1ahwc1, d1ahwc2, d1ahwd1, d1ahwe1, d1ahwf1, d1ahwf2

Details for d1ahwe2

PDB Entry: 1ahw, 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwe2:

Sequence; same for both SEQRES and ATOM records:

>d1ahwe2 b.1.1.2 (E:118-214) Immunoglobulin (constant domains of L and H chains) {Fab 5G9 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkki

Timeline for d1ahwe2:

• d1ahwe2 appears in SCOP 1.57
  
• d1ahwe2 appears in the current release, SCOPe 2.08