Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries) |
Domain d1ahwd2: 1ahw D:109-214 [21232] Other proteins in same PDB: d1ahwa1, d1ahwb1, d1ahwb2, d1ahwc1, d1ahwc2, d1ahwd1, d1ahwe1, d1ahwe2, d1ahwf1, d1ahwf2 part of anti-human tissue factor Fab 5G9 |
PDB Entry: 1ahw (more details), 3 Å
SCOP Domain Sequences for d1ahwd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahwd2 b.1.1.2 (D:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1ahwd2: