SCOPe 2.06: Domain d3kdne1: 3kdn E:7-135

Lineage for d3kdne1 (3kdn E:7-135)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (18 species)
   not a true protein

7. Species Thermococcus kodakaraensis [TaxId:69014] [225982] (2 PDB entries)

8. Domain d3kdne1: 3kdn E:7-135 [212311]
   Other proteins in same PDB: d3kdna2, d3kdnb2, d3kdnc2, d3kdnd2, d3kdne2, d3kdnf2, d3kdng2, d3kdnh2, d3kdni2, d3kdnj2
   automated match to d1bxna2
   complexed with cap, mg; mutant

Details for d3kdne1

PDB Entry: 3kdn, 2.09 Å

PDB Description: crystal structure of type iii rubisco sp4 mutant complexed with 2-cabp

PDB Compounds: (E:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3kdne1:

Sequence; same for both SEQRES and ATOM records:

>d3kdne1 d.58.9.0 (E:7-135) automated matches {Thermococcus kodakaraensis [TaxId: 69014]}
tiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqer
wadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledl
yfpeklire

Timeline for d3kdne1:

• d3kdne1 first appeared in SCOPe 2.03
  
• d3kdne1 appears in SCOPe 2.05
  
• d3kdne1 appears in SCOPe 2.07
  
• d3kdne1 appears in the current release, SCOPe 2.08