SCOPe 2.07: Domain d3kdml1: 3kdm L:3-111

Lineage for d3kdml1 (3kdm L:3-111)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d3kdml1: 3kdm L:3-111 [212301]
   automated match to d1sy6l1
   complexed with tes

Details for d3kdml1

PDB Entry: 3kdm, 1.5 Å

PDB Description: crystal structure of human anti-steroid fab 5f2 in complex with testosterone

PDB Compounds: (L:) immunoglobulin light chain

SCOPe Domain Sequences for d3kdml1:

Sequence; same for both SEQRES and ATOM records:

>d3kdml1 b.1.1.0 (L:3-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altqpasvsgspgqsitisctgtssdvggynyvswyqqhpgkapklmiygvtnrpsgvsn
rfsgsksgntasltisglqagdeadyycssytstrtpyvfgtgtkveik

Timeline for d3kdml1:

• d3kdml1 first appeared in SCOPe 2.03
  
• d3kdml1 appears in SCOPe 2.06
  
• d3kdml1 appears in the current release, SCOPe 2.08