SCOP 1.73: Domain d1ahwa2: 1ahw A:109-214

Lineage for d1ahwa2 (1ahw A:109-214)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d1ahwa2: 1ahw A:109-214 [21230]
   Other proteins in same PDB: d1ahwa1, d1ahwb1, d1ahwb2, d1ahwc1, d1ahwc2, d1ahwd1, d1ahwe1, d1ahwe2, d1ahwf1, d1ahwf2

Details for d1ahwa2

PDB Entry: 1ahw, 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

PDB Compounds: (A:) immunoglobulin fab 5g9 (light chain)

SCOP Domain Sequences for d1ahwa2:

Sequence; same for both SEQRES and ATOM records:

>d1ahwa2 b.1.1.2 (A:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1ahwa2:

• d1ahwa2 first appeared (with stable ids) in SCOP 1.55
  
• d1ahwa2 appears in SCOP 1.71
  
• d1ahwa2 appears in SCOP 1.75
  
• d1ahwa2 appears in the current release, SCOPe 2.08