SCOPe 2.05: Domain d3kcza1: 3kcz A:224-364

Lineage for d3kcza1 (3kcz A:224-364)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.0: automated matches [227223] (1 protein)
   not a true family

6. Protein automated matches [226964] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225405] (32 PDB entries)

8. Domain d3kcza1: 3kcz A:224-364 [212295]
   Other proteins in same PDB: d3kcza2, d3kczb2
   automated match to d1gs0a1
   protein/DNA complex; complexed with 3ab, gol

Details for d3kcza1

PDB Entry: 3kcz, 2 Å

PDB Description: Human poly(ADP-ribose) polymerase 2, catalytic fragment in complex with an inhibitor 3-aminobenzamide

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 2

SCOPe Domain Sequences for d3kcza1:

Sequence; same for both SEQRES and ATOM records:

>d3kcza1 a.41.1.0 (A:224-364) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgtenlyfqsmdlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslk
kiedciragqhgralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieia
iklvktelqspehpldqhyrn

Timeline for d3kcza1:

• d3kcza1 first appeared in SCOPe 2.03
  
• d3kcza1 appears in SCOPe 2.04
  
• d3kcza1 appears in SCOPe 2.06
  
• d3kcza1 appears in the current release, SCOPe 2.08