Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (86 species) not a true protein |
Species Rhodopirellula baltica [TaxId:265606] [225785] (1 PDB entry) |
Domain d3kcna1: 3kcn A:6-139 [212292] Other proteins in same PDB: d3kcna2, d3kcnb2 automated match to d1l5ya_ |
PDB Entry: 3kcn (more details), 2.45 Å
SCOPe Domain Sequences for d3kcna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kcna1 c.23.1.0 (A:6-139) automated matches {Rhodopirellula baltica [TaxId: 265606]} nerillvdddysllntlkrnlsfdfevttcesgpealacikksdpfsvimvdmrmpgmeg teviqkarlispnsvylmltgnqdlttameavnegqvfrflnkpcqmsdikaainagikq ydlvtskeellkkt
Timeline for d3kcna1: