![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries) |
![]() | Domain d1fgnh2: 1fgn H:118-214 [21229] Other proteins in same PDB: d1fgnh1, d1fgnl1, d1fgnl2 part of anti-human tissue factor Fab 5G9 |
PDB Entry: 1fgn (more details), 2.5 Å
SCOP Domain Sequences for d1fgnh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fgnh2 b.1.1.2 (H:118-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkki
Timeline for d1fgnh2: