SCOP 1.71: Domain d1fgnl2: 1fgn L:109-214

Lineage for d1fgnl2 (1fgn L:109-214)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)

8. Domain d1fgnl2: 1fgn L:109-214 [21228]
   Other proteins in same PDB: d1fgnh1, d1fgnh2, d1fgnl1
   part of anti-human tissue factor Fab 5G9

Details for d1fgnl2

PDB Entry: 1fgn, 2.5 Å

PDB Description: monoclonal murine antibody 5g9-anti-human tissue factor

SCOP Domain Sequences for d1fgnl2:

Sequence; same for both SEQRES and ATOM records:

>d1fgnl2 b.1.1.2 (L:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1fgnl2:

• d1fgnl2 first appeared (with stable ids) in SCOP 1.55
  
• d1fgnl2 appears in SCOP 1.69
  
• d1fgnl2 appears in SCOP 1.73
  
• d1fgnl2 appears in the current release, SCOPe 2.08