Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1ad9b2: 1ad9 B:114-212 [21227] Other proteins in same PDB: d1ad9a1, d1ad9a2, d1ad9b1, d1ad9h1, d1ad9l1, d1ad9l2 part of humanized Fab CTM01 complexed with so4 |
PDB Entry: 1ad9 (more details), 2.8 Å
SCOP Domain Sequences for d1ad9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ad9b2 b.1.1.2 (B:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)} astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtktytcnvdhkpsntkvdkrve
Timeline for d1ad9b2: