Lineage for d1ad9a2 (1ad9 A:108-213)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8883Species Fab CTM01 (human construct), kappa L chain [49055] (1 PDB entry)
  8. 8884Domain d1ad9a2: 1ad9 A:108-213 [21226]
    Other proteins in same PDB: d1ad9a1, d1ad9b1, d1ad9h1, d1ad9l1

Details for d1ad9a2

PDB Entry: 1ad9 (more details), 2.8 Å

PDB Description: igg-fab fragment of engineered human monoclonal antibody ctm01

SCOP Domain Sequences for d1ad9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad9a2 b.1.1.2 (A:108-213) Immunoglobulin (constant domains of L and H chains) {Fab CTM01 (human construct), kappa L chain}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOP Domain Coordinates for d1ad9a2:

Click to download the PDB-style file with coordinates for d1ad9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ad9a2: