Lineage for d3k9wa_ (3k9w A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590710Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1590711Protein automated matches [190459] (36 species)
    not a true protein
  7. 1590734Species Burkholderia pseudomallei [TaxId:320372] [189579] (2 PDB entries)
  8. 1590735Domain d3k9wa_: 3k9w A: [212254]
    automated match to d3pxua_
    complexed with 4ps, act, ade, pg4, so4

Details for d3k9wa_

PDB Entry: 3k9w (more details), 1.6 Å

PDB Description: crystal structure of phosphopantetheine adenylyltransferase from burkholderia pseudomallei with hydrolyzed 3'-dephospho coenzyme a
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3k9wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k9wa_ c.26.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
gsmvvavypgtfdpltrghedlvrrassifdtlvvgvadsrakkpffsleerlkianevl
ghypnvkvmgftgllkdfvrandarvivrglravsdfeyefqmagmnryllpdvetmfmt
psdqyqfisgtivreiaqlggdvskfvfpsvekwltekvaama

SCOPe Domain Coordinates for d3k9wa_:

Click to download the PDB-style file with coordinates for d3k9wa_.
(The format of our PDB-style files is described here.)

Timeline for d3k9wa_: