SCOP 1.69: Domain d1ad9l2: 1ad9 L:108-213

Lineage for d1ad9l2 (1ad9 L:108-213)

Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [88569] (78 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Domain d1ad9l2: 1ad9 L:108-213 [21224]
Other proteins in same PDB: d1ad9a1, d1ad9b1, d1ad9b2, d1ad9h1, d1ad9h2, d1ad9l1

Details for d1ad9l2

PDB Entry: 1ad9 (more details), 2.8 Å

PDB Description: igg-fab fragment of engineered human monoclonal antibody ctm01

SCOP Domain Sequences for d1ad9l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad9l2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOP Domain Coordinates for d1ad9l2:

Click to download the PDB-style file with coordinates for d1ad9l2.
(The format of our PDB-style files is described here.)

Timeline for d1ad9l2: