SCOP 1.59: Domain d1ad9l2: 1ad9 L:108-213

Lineage for d1ad9l2 (1ad9 L:108-213)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Fab CTM01 (human construct), kappa L chain [49055] (1 PDB entry)

8. Domain d1ad9l2: 1ad9 L:108-213 [21224]
   Other proteins in same PDB: d1ad9a1, d1ad9b1, d1ad9h1, d1ad9l1

Details for d1ad9l2

PDB Entry: 1ad9, 2.8 Å

PDB Description: igg-fab fragment of engineered human monoclonal antibody ctm01

SCOP Domain Sequences for d1ad9l2:

Sequence; same for both SEQRES and ATOM records:

>d1ad9l2 b.1.1.2 (L:108-213) Immunoglobulin (constant domains of L and H chains) {Fab CTM01 (human construct), kappa L chain}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d1ad9l2:

• d1ad9l2 first appeared (with stable ids) in SCOP 1.55
  
• d1ad9l2 appears in SCOP 1.57
  
• d1ad9l2 appears in SCOP 1.61
  
• d1ad9l2 appears in the current release, SCOPe 2.08