Lineage for d3k92a1 (3k92 A:7-190)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610013Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1610014Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1610318Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 1610319Protein automated matches [226864] (21 species)
    not a true protein
  7. 1610327Species Bacillus subtilis [TaxId:1423] [225904] (2 PDB entries)
  8. 1610328Domain d3k92a1: 3k92 A:7-190 [212225]
    Other proteins in same PDB: d3k92a2, d3k92b2, d3k92c2, d3k92d2, d3k92e2, d3k92f2
    automated match to d1v9la2
    complexed with peg; mutant

Details for d3k92a1

PDB Entry: 3k92 (more details), 2.3 Å

PDB Description: Crystal structure of a E93K mutant of the majour Bacillus subtilis glutamate dehydrogenase RocG
PDB Compounds: (A:) nad-specific glutamate dehydrogenase

SCOPe Domain Sequences for d3k92a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k92a1 c.58.1.0 (A:7-190) automated matches {Bacillus subtilis [TaxId: 1423]}
skdeekealnlflstqtiikealrklgypgdmyelmkepqrmltvripvkmdngsvkvft
gyrsqhndavgptkggvrfhpevneekvkalsiwmtlkcgianlpygggkggiicdprtm
sfgelerlsrgyvraisqivgptkdipapdvytnsqimawmmdeysrlrefdspgfitgk
plvl

SCOPe Domain Coordinates for d3k92a1:

Click to download the PDB-style file with coordinates for d3k92a1.
(The format of our PDB-style files is described here.)

Timeline for d3k92a1: