Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [49053] (4 PDB entries) |
Domain d1d5bh2: 1d5b H:114-214 [21219] Other proteins in same PDB: d1d5ba1, d1d5bb1, d1d5bh1, d1d5bl1 |
PDB Entry: 1d5b (more details), 2.8 Å
SCOP Domain Sequences for d1d5bh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5bh2 b.1.1.2 (H:114-214) Immunoglobulin (constant domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d1d5bh2: