Lineage for d1axsb2 (1axs B:114-214)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221908Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [49053] (4 PDB entries)
  8. 221914Domain d1axsb2: 1axs B:114-214 [21217]
    Other proteins in same PDB: d1axsa1, d1axsb1, d1axsh1, d1axsl1
    complexed with cd, hop

Details for d1axsb2

PDB Entry: 1axs (more details), 2.6 Å

PDB Description: mature oxy-cope catalytic antibody with hapten

SCOP Domain Sequences for d1axsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axsb2 b.1.1.2 (B:114-214) Immunoglobulin (constant domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOP Domain Coordinates for d1axsb2:

Click to download the PDB-style file with coordinates for d1axsb2.
(The format of our PDB-style files is described here.)

Timeline for d1axsb2: