Lineage for d1axsb2 (1axs B:114-214)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) 
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) 
Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [49053] (4 PDB entries) 
Domain d1axsb2: 1axs B:114-214 [21217]
Other proteins in same PDB: d1axsa1, d1axsb1, d1axsh1, d1axsl1
Details for d1axsb2
PDB Entry: 1axs (more details), 2.6 Å
PDB Description: mature oxy-cope catalytic antibody with hapten
SCOP Domain Sequences for d1axsb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1axsb2 b.1.1.2 (B:114-214) Immunoglobulin (constant domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
SCOP Domain Coordinates for d1axsb2:
Click to download the PDB-style file with coordinates for d1axsb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1axsb2:
View in 3D
