SCOPe 2.08: Domain d3k4ha1: 3k4h A:7-284

Lineage for d3k4ha1 (3k4h A:7-284)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Bacillus cytotoxicus [TaxId:315749] [225781] (1 PDB entry)

8. Domain d3k4ha1: 3k4h A:7-284 [212163]
   Other proteins in same PDB: d3k4ha2
   automated match to d3hs3b_

Details for d3k4ha1

PDB Entry: 3k4h, 2.8 Å

PDB Description: crystal structure of putative transcriptional regulator laci from bacillus cereus subsp. cytotoxis nvh 391-98

PDB Compounds: (A:) Putative transcriptional regulator

SCOPe Domain Sequences for d3k4ha1:

Sequence; same for both SEQRES and ATOM records:

>d3k4ha1 c.93.1.0 (A:7-284) automated matches {Bacillus cytotoxicus [TaxId: 315749]}
ttktlglvmpssaskafqnpffpevirgissfahvegyalymstgeteeeifngvvkmvq
grqiggiillysrendriiqylheqnfpfvligkpydrkdeityvdndnytaarevaeyl
islghkqiafigggsdllvtrdrlagmsdalkladivlpkeyilhfdfsresgqqaveel
mglqqpptaimatddliglgvlsalskkgfvvpkdvsivsfnnallseiaspplstvdvn
iyqlgyeaakalvdkvenaestakciiiphkllkrqtc

Timeline for d3k4ha1:

• d3k4ha1 first appeared in SCOPe 2.03, called d3k4ha_
  
• d3k4ha1 appears in SCOPe 2.07