Lineage for d3k2zb2 (3k2z B:72-197)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332990Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
    complex fold made of several coiled beta-sheets; contains an SH3-like barrel
  4. 1332991Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families) (S)
  5. 1333045Family b.87.1.0: automated matches [227255] (1 protein)
    not a true family
  6. 1333046Protein automated matches [227040] (1 species)
    not a true protein
  7. 1333047Species Thermotoga maritima [TaxId:2336] [225981] (1 PDB entry)
  8. 1333049Domain d3k2zb2: 3k2z B:72-197 [212162]
    Other proteins in same PDB: d3k2za1, d3k2zb1
    automated match to d1jhfa2
    complexed with gol

Details for d3k2zb2

PDB Entry: 3k2z (more details), 1.37 Å

PDB Description: crystal structure of a lexa protein from thermotoga maritima
PDB Compounds: (B:) lexa repressor

SCOPe Domain Sequences for d3k2zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k2zb2 b.87.1.0 (B:72-197) automated matches {Thermotoga maritima [TaxId: 2336]}
rnkipligeiragekreaieyledyieipesflssgydhfllkvkgesmieehicdgdlv
lvrrqdwaqngdivaamvdgevtlakfyqrgdtvelrpanremssmffraekvkilgkvv
gvfrkl

SCOPe Domain Coordinates for d3k2zb2:

Click to download the PDB-style file with coordinates for d3k2zb2.
(The format of our PDB-style files is described here.)

Timeline for d3k2zb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3k2zb1