Class b: All beta proteins [48724] (174 folds) |
Fold b.87: LexA/Signal peptidase [51305] (1 superfamily) complex fold made of several coiled beta-sheets; contains an SH3-like barrel |
Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families) |
Family b.87.1.0: automated matches [227255] (1 protein) not a true family |
Protein automated matches [227040] (1 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [225981] (1 PDB entry) |
Domain d3k2zb2: 3k2z B:72-197 [212162] Other proteins in same PDB: d3k2za1, d3k2zb1 automated match to d1jhfa2 complexed with gol |
PDB Entry: 3k2z (more details), 1.37 Å
SCOPe Domain Sequences for d3k2zb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k2zb2 b.87.1.0 (B:72-197) automated matches {Thermotoga maritima [TaxId: 2336]} rnkipligeiragekreaieyledyieipesflssgydhfllkvkgesmieehicdgdlv lvrrqdwaqngdivaamvdgevtlakfyqrgdtvelrpanremssmffraekvkilgkvv gvfrkl
Timeline for d3k2zb2: