SCOP 1.65: Domain d1axsl2: 1axs L:108-211

Lineage for d1axsl2 (1axs L:108-211)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Domain d1axsl2: 1axs L:108-211 [21214]
Other proteins in same PDB: d1axsa1, d1axsb1, d1axsb2, d1axsh1, d1axsh2, d1axsl1

Details for d1axsl2

PDB Entry: 1axs (more details), 2.6 Å

PDB Description: mature oxy-cope catalytic antibody with hapten

SCOP Domain Sequences for d1axsl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axsl2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOP Domain Coordinates for d1axsl2:

Click to download the PDB-style file with coordinates for d1axsl2.
(The format of our PDB-style files is described here.)

Timeline for d1axsl2: