Class b: All beta proteins [48724] (176 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) |
Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins) |
Protein FimC [49588] (1 species) |
Species Escherichia coli [TaxId:562] [49589] (8 PDB entries) |
Domain d3jwni2: 3jwn I:122-205 [212130] Other proteins in same PDB: d3jwnc1, d3jwnh1, d3jwnh2, d3jwni1, d3jwnn1, d3jwnn2 automated match to d1bf8a2 complexed with gol |
PDB Entry: 3jwn (more details), 2.69 Å
SCOPe Domain Sequences for d3jwni2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jwni2 b.7.2.1 (I:122-205) FimC {Escherichia coli [TaxId: 562]} lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda gsnityrtindygaltpkmtgvme
Timeline for d3jwni2: