SCOPe 2.04: Domain d3jv5d_: 3jv5 D:

Lineage for d3jv5d_ (3jv5 D:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (39 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226768] (5 PDB entries)

8. Domain d3jv5d_: 3jv5 D: [212120]
   automated match to d1my5a_

Details for d3jv5d_

PDB Entry: 3jv5, 2.65 Å

PDB Description: Crystal structure of the dimerization domains p52 homodimer

PDB Compounds: (D:) Nuclear factor NF-kappa-B p100 subunit

SCOPe Domain Sequences for d3jv5d_:

Sequence; same for both SEQRES and ATOM records:

>d3jv5d_ b.1.18.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
snlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdfsptdvhkqy
aivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyyp

Timeline for d3jv5d_:

• d3jv5d_ first appeared in SCOPe 2.03
  
• d3jv5d_ appears in SCOPe 2.05
  
• d3jv5d_ appears in the current release, SCOPe 2.08