Lineage for d1d6vl2 (1d6v L:108-211)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516253Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1516254Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1516293Domain d1d6vl2: 1d6v L:108-211 [21212]
    Other proteins in same PDB: d1d6vh1, d1d6vh2, d1d6vl1
    part of humanized oxy-cope catalytic Fab az-28
    complexed with cd, hop

Details for d1d6vl2

PDB Entry: 1d6v (more details), 2 Å

PDB Description: conformation effects in biological catalysis introduced by oxy-cope antibody maturation
PDB Compounds: (L:) chimeric germline precursor of oxy-cope catalytic antibody az-28 (light chain)

SCOPe Domain Sequences for d1d6vl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6vl2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d1d6vl2:

Click to download the PDB-style file with coordinates for d1d6vl2.
(The format of our PDB-style files is described here.)

Timeline for d1d6vl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d6vl1