SCOP 1.59: Domain d1d6vl2: 1d6v L:108-211

Lineage for d1d6vl2 (1d6v L:108-211)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [49053] (4 PDB entries)

8. Domain d1d6vl2: 1d6v L:108-211 [21212]
   Other proteins in same PDB: d1d6vh1, d1d6vl1

Details for d1d6vl2

PDB Entry: 1d6v, 2 Å

PDB Description: conformation effects in biological catalysis introduced by oxy-cope antibody maturation

SCOP Domain Sequences for d1d6vl2:

Sequence; same for both SEQRES and ATOM records:

>d1d6vl2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d1d6vl2:

• d1d6vl2 first appeared (with stable ids) in SCOP 1.55
  
• d1d6vl2 appears in SCOP 1.57
  
• d1d6vl2 appears in SCOP 1.61
  
• d1d6vl2 appears in the current release, SCOPe 2.08