Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [226768] (1 PDB entry) |
Domain d3jv5b_: 3jv5 B: [212118] automated match to d1my5a_ |
PDB Entry: 3jv5 (more details), 2.65 Å
SCOPe Domain Sequences for d3jv5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jv5b_ b.1.18.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} snlkisrmdktagsvrggdevyllcdkvqkddievrfyeddengwqafgdfsptdvhkqy aivfrtppyhkmkierpvtvflqlkrkrggdvsdskqftyypl
Timeline for d3jv5b_: