Lineage for d3juyb2 (3juy B:143-250)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2032857Domain d3juyb2: 3juy B:143-250 [212106]
    automated match to d1dzba2

Details for d3juyb2

PDB Entry: 3juy (more details), 2.5 Å

PDB Description: crystal structure of a 3b3 variant, a broadly neutralizing hiv-1 scfv antibody
PDB Compounds: (B:) 3B3 single chain variant HIV-1 antibody

SCOPe Domain Sequences for d3juyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3juyb2 b.1.1.0 (B:143-250) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqapgtlslspgeratfscrsshsirsrrvawyqhkpgqaprlvihgvsnrasgis
drfsgsgsgtdftltitrvepedfalyycqvygassytfgqgtklerk

SCOPe Domain Coordinates for d3juyb2:

Click to download the PDB-style file with coordinates for d3juyb2.
(The format of our PDB-style files is described here.)

Timeline for d3juyb2: