SCOP 1.69: Domain d1d5il2: 1d5i L:108-211

Lineage for d1d5il2 (1d5i L:108-211)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (78 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1d5il2: 1d5i L:108-211 [21210]
   Other proteins in same PDB: d1d5ih1, d1d5ih2, d1d5il1
   part of humanized oxy-cope catalytic Fab az-28

Details for d1d5il2

PDB Entry: 1d5i, 2 Å

PDB Description: unliganded germline precursor of an oxy-cope catalytic antibody

SCOP Domain Sequences for d1d5il2:

Sequence; same for both SEQRES and ATOM records:

>d1d5il2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d1d5il2:

• d1d5il2 first appeared (with stable ids) in SCOP 1.55
  
• d1d5il2 appears in SCOP 1.67
  
• d1d5il2 appears in SCOP 1.71
  
• d1d5il2 appears in the current release, SCOPe 2.08