Lineage for d1d5il2 (1d5i L:108-211)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9267Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [49053] (4 PDB entries)
  8. 9269Domain d1d5il2: 1d5i L:108-211 [21210]
    Other proteins in same PDB: d1d5ih1, d1d5il1

Details for d1d5il2

PDB Entry: 1d5i (more details), 2 Å

PDB Description: unliganded germline precursor of an oxy-cope catalytic antibody

SCOP Domain Sequences for d1d5il2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5il2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOP Domain Coordinates for d1d5il2:

Click to download the PDB-style file with coordinates for d1d5il2.
(The format of our PDB-style files is described here.)

Timeline for d1d5il2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d5il1