Class a: All alpha proteins [46456] (285 folds) |
Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) automatically mapped to Pfam PF02807 |
Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
Protein Arginine kinase, N-domain [48042] (2 species) |
Species Apostichopus japonicus [TaxId:307972] [226828] (2 PDB entries) |
Domain d3ju6c1: 3ju6 C:2-93 [212097] Other proteins in same PDB: d3ju6a2, d3ju6b2, d3ju6c2, d3ju6d2 automated match to d1g0wa1 complexed with anp, arg |
PDB Entry: 3ju6 (more details), 2.45 Å
SCOPe Domain Sequences for d3ju6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ju6c1 a.83.1.1 (C:2-93) Arginine kinase, N-domain {Apostichopus japonicus [TaxId: 307972]} anlnqkkypakddfpnfeghksllskyltadmyaklrdvatpsgytldraiqngvdnpdf hlgllagdeetytvfadlfdpvieeyhngfkk
Timeline for d3ju6c1: