SCOP 1.55: Domain d1aqkh2: 1aqk H:124-226

Lineage for d1aqkh2 (1aqk H:124-226)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab B7-15A2 (human), lambda L chain [49052] (1 PDB entry)

8. Domain d1aqkh2: 1aqk H:124-226 [21209]
   Other proteins in same PDB: d1aqkh1, d1aqkl1

Details for d1aqkh2

PDB Entry: 1aqk, 1.84 Å

PDB Description: three-dimensional structure of a human fab with high affinity for tetanus toxoid

SCOP Domain Sequences for d1aqkh2:

Sequence; same for both SEQRES and ATOM records:

>d1aqkh2 b.1.1.2 (H:124-226) Immunoglobulin (constant domains of L and H chains) {Fab B7-15A2 (human), lambda L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d1aqkh2:

• d1aqkh2 appears in SCOP 1.57
  
• d1aqkh2 appears in the current release, SCOPe 2.08