SCOP 1.63: Domain d1aqkl2: 1aqk L:112-216

Lineage for d1aqkl2 (1aqk L:112-216)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab B7-15A2 (human), lambda L chain [49052] (1 PDB entry)

8. Domain d1aqkl2: 1aqk L:112-216 [21208]
   Other proteins in same PDB: d1aqkh1, d1aqkl1

Details for d1aqkl2

PDB Entry: 1aqk, 1.84 Å

PDB Description: three-dimensional structure of a human fab with high affinity for tetanus toxoid

SCOP Domain Sequences for d1aqkl2:

Sequence; same for both SEQRES and ATOM records:

>d1aqkl2 b.1.1.2 (L:112-216) Immunoglobulin (constant domains of L and H chains) {Fab B7-15A2 (human), lambda L chain}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvnagvettkpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapaecs

Timeline for d1aqkl2:

• d1aqkl2 first appeared (with stable ids) in SCOP 1.55
  
• d1aqkl2 appears in SCOP 1.61
  
• d1aqkl2 appears in SCOP 1.65
  
• d1aqkl2 appears in the current release, SCOPe 2.08