Class b: All beta proteins [48724] (177 folds) |
Fold b.87: LexA/Signal peptidase [51305] (1 superfamily) complex fold made of several coiled beta-sheets; contains an SH3-like barrel |
Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families) |
Family b.87.1.1: LexA-related [51307] (4 proteins) |
Protein automated matches [227038] (1 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225938] (2 PDB entries) |
Domain d3jspa2: 3jsp A:75-199 [212077] Other proteins in same PDB: d3jspa1, d3jspb1 automated match to d1jhfa2 protein/DNA complex |
PDB Entry: 3jsp (more details), 2.9 Å
SCOPe Domain Sequences for d3jspa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jspa2 b.87.1.1 (A:75-199) automated matches {Escherichia coli K-12 [TaxId: 83333]} glplvgrvaagepllaqqhieghyqvdpslfkpnadfllrvsgmsmkdigimdgdllavh ktqdvrngqvvvariddevtvarlkkqgnkvellpensefkpivvdlrqqsftieglavg virng
Timeline for d3jspa2: