SCOPe 2.03: Domain d3jspa2: 3jsp A:75-199

Lineage for d3jspa2 (3jsp A:75-199)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
   complex fold made of several coiled beta-sheets; contains an SH3-like barrel

4. Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families)

5. Family b.87.1.1: LexA-related [51307] (4 proteins)

6. Protein automated matches [227038] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [225938] (2 PDB entries)

8. Domain d3jspa2: 3jsp A:75-199 [212077]
   Other proteins in same PDB: d3jspa1, d3jspb1
   automated match to d1jhfa2
   protein/DNA complex

Details for d3jspa2

PDB Entry: 3jsp, 2.9 Å

PDB Description: classic protein with a new twist: crystal structure of a lexa repressor dna complex

PDB Compounds: (A:) lexa repressor

SCOPe Domain Sequences for d3jspa2:

Sequence; same for both SEQRES and ATOM records:

>d3jspa2 b.87.1.1 (A:75-199) automated matches {Escherichia coli [TaxId: 83333]}
glplvgrvaagepllaqqhieghyqvdpslfkpnadfllrvsgmsmkdigimdgdllavh
ktqdvrngqvvvariddevtvarlkkqgnkvellpensefkpivvdlrqqsftieglavg
virng

Timeline for d3jspa2:

• d3jspa2 is new in SCOPe 2.03-stable
  
• d3jspa2 appears in SCOPe 2.04
  
• d3jspa2 appears in the current release, SCOPe 2.08