Lineage for d3jsoa2 (3jso A:75-199)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810080Fold b.87: LexA/Signal peptidase [51305] (1 superfamily)
    complex fold made of several coiled beta-sheets; contains an SH3-like barrel
  4. 1810081Superfamily b.87.1: LexA/Signal peptidase [51306] (3 families) (S)
  5. 1810082Family b.87.1.1: LexA-related [51307] (4 proteins)
  6. 1810112Protein automated matches [227038] (1 species)
    not a true protein
  7. 1810113Species Escherichia coli K-12 [TaxId:83333] [225938] (2 PDB entries)
  8. 1810114Domain d3jsoa2: 3jso A:75-199 [212073]
    Other proteins in same PDB: d3jsoa1, d3jsob1
    automated match to d1jhfa2
    protein/DNA complex

Details for d3jsoa2

PDB Entry: 3jso (more details), 2.29 Å

PDB Description: classic protein with a new twist: crystal structure of a lexa repressor dna complex
PDB Compounds: (A:) lexa repressor

SCOPe Domain Sequences for d3jsoa2:

Sequence, based on SEQRES records: (download)

>d3jsoa2 b.87.1.1 (A:75-199) automated matches {Escherichia coli K-12 [TaxId: 83333]}
glplvgrvaagepllaqqhieghyqvdpslfkpnadfllrvsgmsmkdigimdgdllavh
ktqdvrngqvvvariddevtvarlkkqgnkvellpensefkpivvdlrqqsftieglavg
virng

Sequence, based on observed residues (ATOM records): (download)

>d3jsoa2 b.87.1.1 (A:75-199) automated matches {Escherichia coli K-12 [TaxId: 83333]}
glplvgrvaageplieghyqvdpslfkpnadfllrvsgmsmkdigimdgdllavhktqdv
rngqvvvariddevtvarlkkqgnkvellpensefkpivvdlrqqsftieglavgvirng

SCOPe Domain Coordinates for d3jsoa2:

Click to download the PDB-style file with coordinates for d3jsoa2.
(The format of our PDB-style files is described here.)

Timeline for d3jsoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3jsoa1