SCOP 1.69: Domain d2h1ph2: 2h1p H:421-520

Lineage for d2h1ph2 (2h1p H:421-520)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)

8. Domain d2h1ph2: 2h1p H:421-520 [21207]
   Other proteins in same PDB: d2h1ph1, d2h1pl1, d2h1pl2
   part of polysaccharide binding antibody 2H1P

Details for d2h1ph2

PDB Entry: 2h1p, 2.4 Å

PDB Description: the three-dimensional structures of a polysaccharide binding antibody to cryptococcus neoformans and its complex with a peptide from a phage display library: implications for the identification of peptide mimotopes

SCOP Domain Sequences for d2h1ph2:

Sequence; same for both SEQRES and ATOM records:

>d2h1ph2 b.1.1.2 (H:421-520) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d2h1ph2:

• d2h1ph2 first appeared (with stable ids) in SCOP 1.55
  
• d2h1ph2 appears in SCOP 1.67
  
• d2h1ph2 appears in SCOP 1.71
  
• d2h1ph2 appears in the current release, SCOPe 2.08