Class a: All alpha proteins [46456] (285 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (26 species) not a true protein |
Species Anaplasma phagocytophilum [TaxId:212042] [225757] (1 PDB entry) |
Domain d3js4c1: 3js4 C:1-89 [212068] Other proteins in same PDB: d3js4a2, d3js4b2, d3js4c2, d3js4d2 automated match to d1unfx1 complexed with fe, na |
PDB Entry: 3js4 (more details), 1.95 Å
SCOPe Domain Sequences for d3js4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3js4c1 a.2.11.0 (C:1-89) automated matches {Anaplasma phagocytophilum [TaxId: 212042]} mfelsdlpyeglepyisshlldrhynghhktyvdvlnklvvgtefeglgneslgdivvka hnsgsagraifnnaaqiwnhdfywqsmkp
Timeline for d3js4c1: