Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (25 species) not a true protein |
Species Anaplasma phagocytophilum [TaxId:212042] [225758] (1 PDB entry) |
Domain d3js4a2: 3js4 A:90-206 [212065] Other proteins in same PDB: d3js4a1, d3js4b1, d3js4c1, d3js4d1 automated match to d1unfx2 complexed with fe, na |
PDB Entry: 3js4 (more details), 1.95 Å
SCOPe Domain Sequences for d3js4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3js4a2 d.44.1.0 (A:90-206) automated matches {Anaplasma phagocytophilum [TaxId: 212042]} ngggnppeklremiehsfgsvegfnnafttsglgqfgsgwvwlvydedakalkvvstana dsplltqgqlplatmdvwehayyldylnlrkkyidvflehllnwdfvlgrledagvl
Timeline for d3js4a2: