SCOP 1.59: Domain d1nfdh2: 1nfd H:115-228

Lineage for d1nfdh2 (1nfd H:115-228)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Fab H57 (hamster), lambda L chain [49050] (1 PDB entry)

8. Domain d1nfdh2: 1nfd H:115-228 [21205]
   Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde1, d1nfdf1, d1nfdg1, d1nfdh1

Details for d1nfdh2

PDB Entry: 1nfd, 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody

SCOP Domain Sequences for d1nfdh2:

Sequence; same for both SEQRES and ATOM records:

>d1nfdh2 b.1.1.2 (H:115-228) Immunoglobulin (constant domains of L and H chains) {Fab H57 (hamster), lambda L chain}
tttapsvyplapacdsttsttdtvtlgclvkgyfpepvtvswnsgaltsgvhtfpsvlhs
glyslsssvtvpsstwpkqpitcnvahpasstkvdkkiepr

Timeline for d1nfdh2:

• d1nfdh2 first appeared (with stable ids) in SCOP 1.55
  
• d1nfdh2 appears in SCOP 1.57
  
• d1nfdh2 appears in SCOP 1.61
  
• d1nfdh2 appears in the current release, SCOPe 2.08