Lineage for d1nfdf2 (1nfd F:115-228)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358964Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2358965Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [88579] (1 PDB entry)
  8. 2358966Domain d1nfdf2: 1nfd F:115-228 [21203]
    Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde1, d1nfde2, d1nfdf1, d1nfdg1, d1nfdg2, d1nfdh1
    part of Fab H57
    complexed with nag, ndg

Details for d1nfdf2

PDB Entry: 1nfd (more details), 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
PDB Compounds: (F:) h57 fab

SCOPe Domain Sequences for d1nfdf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfdf2 b.1.1.2 (F:115-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
tttapsvyplapacdsttsttdtvtlgclvkgyfpepvtvswnsgaltsgvhtfpsvlhs
glyslsssvtvpsstwpkqpitcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d1nfdf2:

Click to download the PDB-style file with coordinates for d1nfdf2.
(The format of our PDB-style files is described here.)

Timeline for d1nfdf2: