![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
![]() | Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [88579] (1 PDB entry) |
![]() | Domain d1nfdf2: 1nfd F:115-228 [21203] Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde1, d1nfde2, d1nfdf1, d1nfdg1, d1nfdg2, d1nfdh1 part of Fab H57 complexed with nag, ndg |
PDB Entry: 1nfd (more details), 2.8 Å
SCOPe Domain Sequences for d1nfdf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfdf2 b.1.1.2 (F:115-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} tttapsvyplapacdsttsttdtvtlgclvkgyfpepvtvswnsgaltsgvhtfpsvlhs glyslsssvtvpsstwpkqpitcnvahpasstkvdkkiepr
Timeline for d1nfdf2: