Lineage for d1nfde2 (1nfd E:108-215)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360924Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2360925Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [88573] (1 PDB entry)
  8. 2360926Domain d1nfde2: 1nfd E:108-215 [21202]
    Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde1, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdh1, d1nfdh2
    part of Fab H57
    complexed with nag, ndg

Details for d1nfde2

PDB Entry: 1nfd (more details), 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
PDB Compounds: (E:) h57 fab

SCOPe Domain Sequences for d1nfde2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
gpksspkvtvfppspeelrtnkatlvclvndfypgsatvtwkangatindgvkttkpskq
gqnymtssylsltadqwkshnrvscqvthegetvekslspaecl

SCOPe Domain Coordinates for d1nfde2:

Click to download the PDB-style file with coordinates for d1nfde2.
(The format of our PDB-style files is described here.)

Timeline for d1nfde2: