SCOPe 2.03: Domain d3jpzb1: 3jpz B:3-89

Lineage for d3jpzb1 (3jpz B:3-89)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.0: automated matches [227170] (1 protein)
   not a true family

6. Protein automated matches [226884] (5 species)
   not a true protein

7. Species Innkeeper worm (Urechis caupo) [TaxId:6431] [225963] (2 PDB entries)

8. Domain d3jpzb1: 3jpz B:3-89 [212008]
   Other proteins in same PDB: d3jpza2, d3jpzb2
   automated match to d1g0wa1
   complexed with no3

Details for d3jpzb1

PDB Entry: 3jpz, 1.95 Å

PDB Description: crystal structure of lombricine kinase

PDB Compounds: (B:) Lombricine kinase

SCOPe Domain Sequences for d3jpzb1:

Sequence; same for both SEQRES and ATOM records:

>d3jpzb1 a.83.1.0 (B:3-89) automated matches {Innkeeper worm (Urechis caupo) [TaxId: 6431]}
fqndakanfpdyanhgcvvgrhlnfemyqrlfgkktahgvtvdkviqpsvdnfgncigli
agdeesyevfkelfdavinekhkgfgp

Timeline for d3jpzb1:

• d3jpzb1 is new in SCOPe 2.03-stable
  
• d3jpzb1 appears in SCOPe 2.04
  
• d3jpzb1 appears in the current release, SCOPe 2.07