Lineage for d3jpza2 (3jpz A:90-366)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668438Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1668439Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 1668689Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 1668690Protein automated matches [227028] (5 species)
    not a true protein
  7. 1668740Species Innkeeper worm (Urechis caupo) [TaxId:6431] [225964] (2 PDB entries)
  8. 1668741Domain d3jpza2: 3jpz A:90-366 [212007]
    Other proteins in same PDB: d3jpza1, d3jpzb1
    automated match to d1g0wa2
    complexed with no3

Details for d3jpza2

PDB Entry: 3jpz (more details), 1.95 Å

PDB Description: crystal structure of lombricine kinase
PDB Compounds: (A:) Lombricine kinase

SCOPe Domain Sequences for d3jpza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jpza2 d.128.1.0 (A:90-366) automated matches {Innkeeper worm (Urechis caupo) [TaxId: 6431]}
ndsqpapdldasklvggqfdekyvkscrirtgrgirglcyppsctrgerrevervittal
aglsgdlsgtyyplskmtpeqenqliadhflfqkptghlmvnsasvrdwpdargiwhnne
ktfliwineedhmrvismqkggnvkavferfgrglnaiaeqmkkngreymwnqrlgylca
cpsnlgtglrasvhvqlhqlskhpkfedivvalqlqkrgtggehtaavddvydisnaarl
kkserefvqllidgvkklidmeqaleagksiddlipa

SCOPe Domain Coordinates for d3jpza2:

Click to download the PDB-style file with coordinates for d3jpza2.
(The format of our PDB-style files is described here.)

Timeline for d3jpza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3jpza1