Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (68 species) not a true protein |
Species Xanthomonas campestris [TaxId:340] [225797] (1 PDB entry) |
Domain d3iwzd2: 3iwz D:159-229 [211996] Other proteins in same PDB: d3iwza1, d3iwzb1, d3iwzc1, d3iwzd1 automated match to d2oz6a1 |
PDB Entry: 3iwz (more details), 2.3 Å
SCOPe Domain Sequences for d3iwzd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iwzd2 a.4.5.0 (D:159-229) automated matches {Xanthomonas campestris [TaxId: 340]} dvtdrivrtlhdlskepeamshpqgtqlrvsrqelarlvgcsremagrvlkklqadgllh argktvvlygt
Timeline for d3iwzd2: