Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (8 species) not a true protein |
Species Xanthomonas campestris [TaxId:340] [225796] (1 PDB entry) |
Domain d3iwzb1: 3iwz B:22-158 [211991] Other proteins in same PDB: d3iwza2, d3iwzb2, d3iwzc2, d3iwzd2 automated match to d2oz6a2 |
PDB Entry: 3iwz (more details), 2.3 Å
SCOPe Domain Sequences for d3iwzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iwzb1 b.82.3.0 (B:22-158) automated matches {Xanthomonas campestris [TaxId: 340]} ldagtierflahshrrryptrtdvfrpgdpagtlyyvisgsvsiiaeedddrelvlgyfg sgefvgemglfiesdtrevilrtrtqcelaeisyerlqqlfqtslspdaprilyaigvql skrlldttrkasrlafl
Timeline for d3iwzb1: