Lineage for d1mf2h2 (1mf2 H:114-209)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221506Species Fab F11.2.32 (mouse), kappa L chain [49049] (2 PDB entries)
    against HIV-1 protease
  8. 221511Domain d1mf2h2: 1mf2 H:114-209 [21199]
    Other proteins in same PDB: d1mf2h1, d1mf2l1, d1mf2m1, d1mf2n1

Details for d1mf2h2

PDB Entry: 1mf2 (more details), 2.6 Å

PDB Description: anti hiv1 protease fab complex

SCOP Domain Sequences for d1mf2h2:

Sequence, based on SEQRES records: (download)

>d1mf2h2 b.1.1.2 (H:114-209) Immunoglobulin (constant domains of L and H chains) {Fab F11.2.32 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd

Sequence, based on observed residues (ATOM records): (download)

>d1mf2h2 b.1.1.2 (H:114-209) Immunoglobulin (constant domains of L and H chains) {Fab F11.2.32 (mouse), kappa L chain}
akttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpssprpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1mf2h2:

Click to download the PDB-style file with coordinates for d1mf2h2.
(The format of our PDB-style files is described here.)

Timeline for d1mf2h2: