SCOP 1.63: Domain d2hrpn2: 2hrp N:114-212

Lineage for d2hrpn2 (2hrp N:114-212)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
Species Fab F11.2.32 (mouse), kappa L chain [49049] (2 PDB entries)
against HIV-1 protease
Domain d2hrpn2: 2hrp N:114-212 [21197]
Other proteins in same PDB: d2hrph1, d2hrpl1, d2hrpm1, d2hrpn1

Details for d2hrpn2

PDB Entry: 2hrp (more details), 2.2 Å

PDB Description: antigen-antibody complex

SCOP Domain Sequences for d2hrpn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrpn2 b.1.1.2 (N:114-212) Immunoglobulin (constant domains of L and H chains) {Fab F11.2.32 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d2hrpn2:

Click to download the PDB-style file with coordinates for d2hrpn2.
(The format of our PDB-style files is described here.)

Timeline for d2hrpn2: