Lineage for d3iuyb_ (3iuy B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366245Species Human (Homo sapiens) [TaxId:9606] [186862] (75 PDB entries)
  8. 1366351Domain d3iuyb_: 3iuy B: [211967]
    automated match to d1t6na_
    complexed with amp, cl

Details for d3iuyb_

PDB Entry: 3iuy (more details), 2.4 Å

PDB Description: crystal structure of ddx53 dead-box domain
PDB Compounds: (B:) Probable ATP-dependent RNA helicase DDX53

SCOPe Domain Sequences for d3iuyb_:

Sequence, based on SEQRES records: (download)

>d3iuyb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtcddlksgekrlipkptcrfkdafqqypdllksiirvgilkptpiqsqawpiilqgidl
ivvaqtgtgktlsylmpgfihldsqpisreqrngpgmlvltptrelalhveaecskysyk
glksiciyggrnrngqiediskgvdiiiatpgrlndlqmnnsvnlrsitylvideadkml
dmefepqirkilldvrpdrqtvmtsatwpdtvrqlalsylkdpmivyv

Sequence, based on observed residues (ATOM records): (download)

>d3iuyb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtcddlksgekrlipkptcrfkdafqqypdllksiirvgilkptpiqsqawpiilqgidl
ivvaqtgtgktlsylmpgfihldsngpgmlvltptrelalhveaecskysykglksiciy
gvdiiiatpgrlndlqmnnsvnlrsitylvideadkmldmefepqirkilldvrpdrqtv
mtsatwpdtvrqlalsylkdpmivyv

SCOPe Domain Coordinates for d3iuyb_:

Click to download the PDB-style file with coordinates for d3iuyb_.
(The format of our PDB-style files is described here.)

Timeline for d3iuyb_: