Lineage for d2hrph2 (2hrp H:114-214)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221506Species Fab F11.2.32 (mouse), kappa L chain [49049] (2 PDB entries)
    against HIV-1 protease
  8. 221507Domain d2hrph2: 2hrp H:114-214 [21195]
    Other proteins in same PDB: d2hrph1, d2hrpl1, d2hrpm1, d2hrpn1

Details for d2hrph2

PDB Entry: 2hrp (more details), 2.2 Å

PDB Description: antigen-antibody complex

SCOP Domain Sequences for d2hrph2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrph2 b.1.1.2 (H:114-214) Immunoglobulin (constant domains of L and H chains) {Fab F11.2.32 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d2hrph2:

Click to download the PDB-style file with coordinates for d2hrph2.
(The format of our PDB-style files is described here.)

Timeline for d2hrph2: